Mouse TIMP2 Recombinant monoclonal antibody, PBS Only (Detector)

TIMP2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 85882-2-PBS
Clone No.250231B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Metalloproteinase inhibitor 2, Timp-2, Tissue inhibitor of metalloproteinases 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85882-2-PBS targets TIMP2 as part of a matched antibody pair:

MP02176-3: 85882-4-PBS capture and 85882-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2960

Product name: Recombinant Mouse TIMP2 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 27-220 aa of uniprot无NM号

Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Predict reactive species
Full Name tissue inhibitor of metalloproteinase 2
Calculated Molecular Weight24 kDa
Observed Molecular Weight 20-24 kDa
GenBank Accession Numberuniprot无NM号
Gene Symbol Timp2
Gene ID (NCBI) 21858
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25785
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The TIMPs are natural highly specific endogenous inhibitors of MMPs. Human TIMP family consists of four 21-28 kDa proteins known as TIMP1, TIMP2, TIMP3, and TIMP4 encoded by four paralogous genes.TIMPs are vital to the maintenance of ECM homeostasis primarily through their MMP inhibitory functions. TIMP2, a member of the TIMP family, regulates the proteolytic activity of all MMPs and is involved in cell differentiation, growth, migration, angiogenesis, and apoptosis. Urinary TIMP2 has been recently recognized as an early biomarker to predict Acute kidney injury (AKI) in critically ill patients.

Loading...
||
New chat

Able

正在加载,请稍候...