Mouse Surfactant protein D Recombinant monoclonal antibody, PBS Only (Capture)

Surfactant protein D Uni-rAb® Recombinant Antibody for WB, IHC, IP, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85985-1-PBS
Clone No.250571G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IP, Sandwich ELISA, Indirect ELISA, Sample test

Lung surfactant protein D, PSP-D, Pulmonary surfactant-associated protein D, Sftp4, Sftpd

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85985-1-PBS targets Surfactant protein D as part of a matched antibody pair:

MP02322-1: 85985-1-PBS capture and 85985-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2924

Product name: Recombinant Mouse Surfactant protein D protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 20-374 aa of NM_009160.2

Sequence: AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

Predict reactive species
Full Name surfactant associated protein D
Calculated Molecular Weight38 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberNM_009160.2
Gene Symbol Sftpd
Gene ID (NCBI) 20390
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50404
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Surfactant protein D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses.

Loading...
||
New chat Able
正在加载,请稍候...