Surfactant protein D Recombinant monoclonal antibody

• 

  WB analysis using 85985-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85985-1-RR (Sftpd antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse lung using 85985-1-RR

  IP result of anti-Surfactant protein D (IP:85985-1-RR, 4ug; Detection:85985-1-RR 1:3000) with mouse lung tissue lysate 1760 ug.

• 

  IHC staining of rat lung using 85985-1-RR

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 85985-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 85985-1-RR

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 85985-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Surfactant protein D Uni-rAb^® Recombinant Antibody for WB, IHC, IP, ELISA

Cat No. 85985-1-RR

Clone No.250571G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Lung surfactant protein D, PSP-D, Pulmonary surfactant-associated protein D, Sftp4, Sftpd

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: mouse lung tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85985-1-RR targets Surfactant protein D in WB, IHC, IP, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2924

  Product name: Recombinant Mouse Surfactant protein D protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-374 aa of NM_009160.2

  Sequence: AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

• Full Name: surfactant associated protein D
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_009160.2
• Gene Symbol: Sftpd
• Gene ID (NCBI): 20390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50404
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Surfactant protein D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses.