SCP2/SCPx Recombinant monoclonal antibody

SCP2/SCPx Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 86196-3-RR
Clone No.250813C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

SCP2, Acetyl-CoA C-myristoyltransferase, EC:2.3.1.155, EC:2.3.1.16, EC:2.3.1.176

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, HepG2 cells, HEK-293 cells, U-87 MG cells, NIH/3T3 cells, rat brain tissue
Positive IF/ICC detected ink562

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86196-3-RR targets SCP2/SCPx in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5895

Product name: Recombinant human SCPX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC067108

Sequence: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS

Predict reactive species
Full Name sterol carrier protein 2
Calculated Molecular Weight 59 kDa
Observed Molecular Weight46 kDa, 58 kDa
GenBank Accession NumberBC067108
Gene Symbol SCP2
Gene ID (NCBI) 6342
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22307
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. It recognizes the intact 58 kDa SCPx protein as well as 44-46 kDa thiolase (PMID: 35996156).

Protocols

Product Specific Protocols
IF protocol for SCP2/SCPx antibody 86196-3-RRDownload protocol
WB protocol for SCP2/SCPx antibody 86196-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...