SCP2/SCPx Recombinant monoclonal antibody, PBS Only

SCP2/SCPx Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 86196-3-PBS
Clone No.250813C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

SCP2, Acetyl-CoA C-myristoyltransferase, EC:2.3.1.155, EC:2.3.1.16, EC:2.3.1.176

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86196-3-PBS targets SCP2/SCPx in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5895

Product name: Recombinant human SCPX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC067108

Sequence: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS

Predict reactive species
Full Name sterol carrier protein 2
Calculated Molecular Weight 59 kDa
Observed Molecular Weight46 kDa, 58 kDa
GenBank Accession NumberBC067108
Gene Symbol SCP2
Gene ID (NCBI) 6342
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22307
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. It recognizes the intact 58 kDa SCPx protein as well as 44-46 kDa thiolase (PMID: 35996156).

Loading...
||
New chat

Able

正在加载,请稍候...