STK25 Recombinant monoclonal antibody, PBS Only (Detector)

STK25 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 86216-1-PBS
Clone No.250202A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

EC:2.7.11.1, Serine/threonine-protein kinase 25, SOK 1, SOK1, SOK-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86216-1-PBS targets STK25 as part of a matched antibody pair:

MP02398-1: 86216-2-PBS capture and 86216-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22964

Product name: Recombinant human STK25 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 323-426 aa of BC015793

Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR

Predict reactive species
Full Name serine/threonine kinase 25 (STE20 homolog, yeast)
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC015793
Gene Symbol STK25
Gene ID (NCBI) 10494
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00506
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...