ATP6V1C1 Recombinant monoclonal antibody, PBS Only (Capture)

ATP6V1C1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 86345-2-PBS
Clone No.250958C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

ATP6C, ATP6D, VATC, V-ATPase subunit C 1, Vma5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86345-2-PBS targets ATP6V1C1 as part of a matched antibody pair:

MP02350-1: 86345-2-PBS capture and 86345-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9020

Product name: Recombinant human ATP6V1C1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-381 aa of BC010960

Sequence: MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEF

Predict reactive species
Full Name ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Calculated Molecular Weight 382 aa, 44 kDa
Observed Molecular Weight 42-44 kDa
GenBank Accession NumberBC010960
Gene Symbol ATP6V1C1
Gene ID (NCBI) 528
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21283
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The vacuolar H+-ATPase (V-ATPase) is a functionally conserved multimeric complex localized at the membranes of many organelles where its proton-pumping action is required for proper lumen acidification (PMID: 39210597). ATP6V1C1, also known as ATPase, H+ transporting, lysosomal V1 subunit C1, is a component of the V1 sector of the V-ATPase complex. ATP6v1c1 knockdown significantly reduces tumor stimulated bone resorption through osteoclastogenesis at the bone and metastasis in vivo, as well as V-ATPase activity, proliferation, and mTORC1 activation in vitro (PMID: 28504970). Also, ATP6V1C1, associated with the tumor microenvironment and mTORC1 signaling pathway, is a potential diagnostic, prognostic, and therapeutic biomarker for hepatocellular carcinoma () (PMID: 39557733).

Loading...
||
New chat Able
正在加载,请稍候...