Use Able AI chat for product recommendations

IL-32 Recombinant monoclonal antibody, PBS Only (Detector)

IL-32 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86678-1-PBS
Clone No.250373F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

IL32, IL 32, interleukin 32, interleukin32, Interleukin-32

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86678-1-PBS targets IL-32 as part of a matched antibody pair:

MP02615-1: 86678-2-PBS capture and 86678-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3224

Product name: Recombinant Human IL-32 protein (isoform alpha, rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 1-131 aa of NM_001012633.1

Sequence: MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

Predict reactive species
Full Name interleukin 32
Calculated Molecular Weight15 kDa
Observed Molecular Weight22-25 kDa
GenBank Accession NumberNM_001012633.1
Gene Symbol IL-32
Gene ID (NCBI) 9235
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24001-4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin 32 (IL32) is a member of the cytokine family. IL32 contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. IL32 is a predominantly intracellular proinflammatory cytokine produced by epithelial cells, monocytes, T-lymphocytes and natural killer cells, and is involved in inflammation and cancer development. IL32 is able to induce the release a variety of pro-inflammatory cytokines such as IL8, tumor necrosis factor-α (TNFα) and IL6. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2.

Loading...
||
New chat

Able

正在加载,请稍候...