SPIN1 Recombinant monoclonal antibody, PBS Only (Capture)

SPIN1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 86848-3-PBS
Clone No.251836E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

OCR, Ovarian cancer-related protein, SPIN, SPIN 1, spindlin 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86848-3-PBS targets SPIN1 as part of a matched antibody pair:

MP02730-1: 86848-3-PBS capture and 86848-2-PBS detection (validated in Cytometric bead array)

MP02730-2: 86848-3-PBS capture and 86848-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2750

Product name: Recombinant human SPIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-262 aa of BC013571

Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Predict reactive species
Full Name spindlin 1
Calculated Molecular Weight 262 aa, 30 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC013571
Gene Symbol SPIN1
Gene ID (NCBI) 10927
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y657
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762)

Loading...
||
New chat

Able

正在加载,请稍候...