GLYR1 Recombinant monoclonal antibody

GLYR1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 86877-1-RR
Clone No.251890G7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

3-hydroxyisobutyrate dehydrogenase-like protein, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, HIBDL, hNDF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86877-1-RR targets GLYR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6637

Product name: Recombinant human N-PAC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 133-484 aa of BC064940

Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH

Predict reactive species
Full Name cytokine-like nuclear factor n-pac
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC064940
Gene Symbol N-PAC
Gene ID (NCBI) 84656
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ49A26
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GlyR1 (glyoxylate/successful semi-Aldehyde Reductase 1) is a plant-specific NADPH- dependent reductase, which mainly locates in cytoplasm. It was originally regarded as "glyoxal/succinate semialdehyde reductase", which can reduce glyoxylate, an intermediate product of photorespiration, to glycolate, and also reduce succinate semialdehyde produced by GABA metabolism to γ-hydroxybutyric acid, thus eliminating active aldehydes and alleviating oxidative damage caused by abiotic stress. In invasive breast cancer cells, GLYR1 was detected to "flip" from the nucleus to the cell membrane (ecto-GLYR1) and became a new tumor-specific antigen. Humanized antibody and CAR-NK/CAR-T systems have been established for the membrane epitope, and will soon enter the clinical safety assessment. This means that GLYR1 itself can also be used as a "membrane target antigen" for precise tumor treatment.

Protocols

Product Specific Protocols
IF protocol for GLYR1 antibody 86877-1-RRDownload protocol
WB protocol for GLYR1 antibody 86877-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...