GLYR1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86877-1-RR (same clone as 86877-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86877-1-RR (N-PAC antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86877-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86877-1-RR (same clone as 86877-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using N-PAC antibody (86877-1-RR, Clone: 251890G7 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86877-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02739-1

  The mean GLYR1 concentration was determined to be 8.2 ng/mL in HL-60 cell extract based on a 1.2 mg/mL extract load, 9.4 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02739-1

  Cytometric bead array standard curve of MP02739-1, GLYR1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86877-2-PBS. Detection antibody: 86877-1-PBS. Standard: Ag6637. Range: 0.781-100 ng/mL.

• 

  Affinity of 86877-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86877-1-RR against Human GLYR1 were performed. The affinity constant is 0.332 nM.

GLYR1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 86877-1-PBS

Clone No.251890G7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

3-hydroxyisobutyrate dehydrogenase-like protein, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, HIBDL, hNDF

---

Product Information

86877-1-PBS targets GLYR1 as part of a matched antibody pair:

MP02739-1: 86877-2-PBS capture and 86877-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6637

  Product name: Recombinant human N-PAC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-484 aa of BC064940

  Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH

• Full Name: cytokine-like nuclear factor n-pac
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC064940
• Gene Symbol: N-PAC
• Gene ID (NCBI): 84656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q49A26
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GlyR1 (glyoxylate/successful semi-Aldehyde Reductase 1) is a plant-specific NADPH- dependent reductase, which mainly locates in cytoplasm. It was originally regarded as "glyoxal/succinate semialdehyde reductase", which can reduce glyoxylate, an intermediate product of photorespiration, to glycolate, and also reduce succinate semialdehyde produced by GABA metabolism to γ-hydroxybutyric acid, thus eliminating active aldehydes and alleviating oxidative damage caused by abiotic stress. In invasive breast cancer cells, GLYR1 was detected to "flip" from the nucleus to the cell membrane (ecto-GLYR1) and became a new tumor-specific antigen. Humanized antibody and CAR-NK/CAR-T systems have been established for the membrane epitope, and will soon enter the clinical safety assessment. This means that GLYR1 itself can also be used as a "membrane target antigen" for precise tumor treatment.