OTUD6B Recombinant monoclonal antibody, PBS Only (Capture)

OTUD6B Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 87049-1-PBS
Clone No.251982E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

CGI 77, CGI-77, Deubiquitinase OTUD6B, DUBA 5, DUBA5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87049-1-PBS targets OTUD6B as part of a matched antibody pair:

MP02964-1: 87049-1-PBS capture and 87049-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22044

Product name: Recombinant human OTUD6B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-157 aa of BC029760

Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH

Predict reactive species
Full Name OTU domain containing 6B
Calculated Molecular Weight 293 aa, 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC029760
Gene Symbol OTUD6B
Gene ID (NCBI) 51633
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N6M0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 87049-1-RR can detect the band around 34 kDa.(PMID:32323143)

Loading...
||
New chat

Able

正在加载,请稍候...