SOX10 Recombinant monoclonal antibody, PBS Only (Capture)

SOX10 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 87051-3-PBS
Clone No.252024E10

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10, Transcription factor SOX-10

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87051-3-PBS targets SOX10 as part of a matched antibody pair:

MP02850-2: 87051-3-PBS capture and 87051-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag38090

Product name: Recombinant human SOX10 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 267-466 aa of BC002824

Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 10
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50-65 kDa
GenBank Accession NumberBC002824
Gene Symbol SOX10
Gene ID (NCBI) 6663
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56693
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-65 kDa. (PMID: 23799842, 39982575)

Loading...
||
New chat

Able

正在加载,请稍候...