TMX2 Recombinant monoclonal antibody, PBS Only (Detector)

TMX2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 87183-1-PBS
Clone No.252474C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Cell proliferation-inducing gene 26 protein, CGI 31, CGI31, CGI-31, My009

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87183-1-PBS targets TMX2 as part of a matched antibody pair:

MP02911-1: 87183-2-PBS capture and 87183-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13828

Product name: Recombinant human TMX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 130-296 aa of BC000666

Sequence: PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

Predict reactive species
Full Name thioredoxin-related transmembrane protein 2
Calculated Molecular Weight 296 aa, 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC000666
Gene Symbol TMX2
Gene ID (NCBI) 51075
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y320
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Thioredoxin-related transmembrane proteins (TMXs) are protein disulfide isomerase (PDI) family members and possess a transmembrane region. TMX2 cDNA was first isolated in 2003, and TMX2 mRNA has been found in a variety of human tissues, with the highest levels in the heart, brain, liver, kidney, and pancreas.

Loading...
||
New chat

Able

正在加载,请稍候...