ARPC1B Recombinant monoclonal antibody, PBS Only (Capture)

ARPC1B Uni-rAb® Recombinant Antibody for WB, IP, Cytometric bead array, Indirect ELISA

Cat No. 87393-1-PBS
Clone No.252807F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Cytometric bead array, Indirect ELISA

Actin-related protein 2/3 complex subunit 1B, ARC41, p41 ARC, p41-ARC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87393-1-PBS targets ARPC1B as part of a matched antibody pair:

MP02990-1: 87393-1-PBS capture and 87393-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29001

Product name: Recombinant human ARPC1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 265-372 aa of BC007555

Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK

Predict reactive species
Full Name actin related protein 2/3 complex, subunit 1B, 41kDa
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC007555
Gene Symbol ARPC1B
Gene ID (NCBI) 10095
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15143
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.

Loading...
||
New chat

Able

正在加载,请稍候...