Use Able AI chat for product recommendations

IGF2BP1 Recombinant monoclonal antibody

IGF2BP1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 88123-1-RR
Clone No.260323A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Coding region determinant-binding protein, CRD-BP, IGF2 mRNA-binding protein 1, IGF2BP 1, IGF-II mRNA-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, K-562 cells, Caco-2 cells, IMR-32 cells, 3T3-L1 cells
Positive IF/ICC detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88123-1-RR targets IGF2BP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18859

Product name: Recombinant human IGF2BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 126-198 aa of BC156957

Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 1
Calculated Molecular Weight 577 aa, 63 kDa
Observed Molecular Weight63-70 kDa
GenBank Accession NumberBC156957
Gene Symbol IGF2BP1
Gene ID (NCBI) 10642
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NZI8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa.

Protocols

Product Specific Protocols
IF protocol for IGF2BP1 antibody 88123-1-RRDownload protocol
WB protocol for IGF2BP1 antibody 88123-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...