Use Able AI chat for product recommendations

IGF2BP1 Recombinant monoclonal antibody, PBS Only (Detector)

IGF2BP1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 88123-1-PBS
Clone No.260323A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Coding region determinant-binding protein, CRD-BP, IGF2 mRNA-binding protein 1, IGF2BP 1, IGF-II mRNA-binding protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

88123-1-PBS targets IGF2BP1 as part of a matched antibody pair:

MP03376-1: 88123-2-PBS capture and 88123-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18859

Product name: Recombinant human IGF2BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 126-198 aa of BC156957

Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 1
Calculated Molecular Weight 577 aa, 63 kDa
Observed Molecular Weight63-70 kDa
GenBank Accession NumberBC156957
Gene Symbol IGF2BP1
Gene ID (NCBI) 10642
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NZI8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...