Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse CCL8/MCP-2 Rabbit Recombinant Antibody (98480-1-RR)

Anti-Mouse CCL8/MCP-2 Rabbit Recombinant Antibody

CCL8/MCP-2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98480-1-RR

Clone No. 250174H6

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Ccl8, C-C motif chemokine 8, Ccl 8, CCL-8, chemokine (C C motif) ligand 8

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

PE-Cyanine7

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)Affinity

FC experiment of Transfected HEK-293T using 98480-1-RR
1x10^6 HEK-293T cells (left) or CCL8/MCP-2-transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse CCL8/MCP-2 Rabbit RecAb (98480-1-RR, Clone: 250174H6) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Transfected HEK-293T using 98480-1-RR
1x10^6 HEK-293T cells (left) or CCL8/MCP-2-transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Mouse CCL8/MCP-2 Rabbit RecAb (98480-1-RR, Clone: 250174H6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 98480-1-RR
Biolayer interferometry (BLl) kinetic assays of 98480-1-RR against Mouse CCL8/MCP-2 were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL8/MCP-2 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC (Intra) detected in

Transfected HEK-293T cells

Recommended dilution

Application	Dilution
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98480-1-RR targets CCL8/MCP-2 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2771 Product name: Recombinant Mouse CCL8/MCP-2 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 24-97 aa of NM_021443.3 Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP Predict reactive species
Full Name	chemokine (C-C motif) ligand 8
Calculated Molecular Weight	11 kDa
GenBank Accession Number	NM_021443.3
Gene Symbol	Ccl8
Gene ID (NCBI)	20307
RRID	AB_3746110
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9Z121
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

The cys-cys (C-C) motif chemokine ligand 8 (CCL8, also known as MCP2) is implicated in various inflammatory processes. In bone marrow transplantation, circulating CCL8 levels positively correlate with the severity of graft-versus-host disease.