PE-Cyanine7 Anti-Mouse CCL8/MCP-2 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• PE-Cyanine7 Anti-Mouse CCL8/MCP-2 Rabbit Recombinant Antibody (PY7-98480)

CCL8/MCP-2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. PY7-98480 Copied!

Clone No. 250174H6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Ccl8, C-C motif chemokine 8, Ccl 8, CCL-8, chemokine (C C motif) ligand 8

• 

  FC experiment of Transfected HEK-293T using PY7-98480

  1x10^6 HEK-293T cells (left) or CCL8/MCP-2-transfected HEK-293T cells (right) were intracellularly stained with 0.1 ug PE-Cyanine7 Anti-Mouse CCL8/MCP-2 Rabbit RecAb (PY7-98480, Clone: 250174H6). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using PY7-98480

  1x10^6 HEK-293T cells (left) or CCL8/MCP-2-transfected HEK-293T cells (right) were intracellularly stained with 0.1 ug PE-Cyanine7 Anti-Mouse CCL8/MCP-2 Rabbit RecAb (PY7-98480, Clone: 250174H6) (red) or 0.1 ug PE-Cyanine7 Rabbit IgG Isotype Control RecAb (PY7-98136, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCL8/MCP-2 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PY7-98480 targets CCL8/MCP-2 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2771

  Product name: Recombinant Mouse CCL8/MCP-2 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-97 aa of NM_021443.3

  Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

• Full Name: chemokine (C-C motif) ligand 8
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: NM_021443.3
• Gene Symbol: Ccl8
• Gene ID (NCBI): 20307
• RRID: AB_3750008
• Conjugate: PE-Cyanine7 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 778 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Z121
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The cys-cys (C-C) motif chemokine ligand 8 (CCL8, also known as MCP2) is implicated in various inflammatory processes. In bone marrow transplantation, circulating CCL8 levels positively correlate with the severity of graft-versus-host disease.