Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IP detected in | HeLa cells, mouse brain tissue |
| Positive IHC detected in | human heart tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12295-1-AP targets Prohibitin 2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA, Electrochemical Immunosensor applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, rice |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2977 Product name: Recombinant human PHB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC014766 Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK Predict reactive species |
| Full Name | prohibitin 2 |
| Calculated Molecular Weight | 299 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC014766 |
| Gene Symbol | Prohibitin 2 |
| Gene ID (NCBI) | 11331 |
| RRID | AB_2164779 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99623 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Prohibitin 2 antibody 12295-1-AP | Download protocol |
| IF protocol for Prohibitin 2 antibody 12295-1-AP | Download protocol |
| IHC protocol for Prohibitin 2 antibody 12295-1-AP | Download protocol |
| IP protocol for Prohibitin 2 antibody 12295-1-AP | Download protocol |
| WB protocol for Prohibitin 2 antibody 12295-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-PHB2 (Prohibitin 2) Antibody, Cat# 12295-1-AP has 69 citations across journals including Cell Research, Nature Communications, Neuron, Autophagy, Molecular Cell, EMBO Journal, JBC, Oncogene, Leukemia, Hepatology, and Cell Reports. Research fields span mitophagy, autophagy, mitochondrial biology, cancer (breast, colorectal, renal, prostate), neurodegeneration, cardiovascular disease, and inflammation. Applications are predominantly Western blot, with IF, CoIP, and IHC also represented.
| Species | Application | Title |
|---|---|---|
Cell Res The STX17-SNAP47-VAMP7/VAMP8 complex is the default SNARE complex mediating autophagosome-lysosome fusion | ||
Autophagy Salmonella Typhimurium persistently infects host via its effector SseJ-induced PHB2-mediated mitophagy
| ||
Autophagy PHB2 (prohibitin 2) promotes PINK1-PRKN/Parkin-dependent mitophagy by the PARL-PGAM5-PINK1 axis.
| ||
Nat Commun Spatial mapping of juxtacrine axo-glial interactions identifies novel molecules in peripheral myelination. | ||
Reviews
What customers say
One reviewer, Sara Hernandez, rated this product 5 stars in October 2024. She used it for immunofluorescence with mouse primary lymphocytes and reported that it works well, showing clear mitochondrial localization (lot 00049480).
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sara (Verified Customer) (10-10-2024) | It works well in immunofluorescence using mouse primary lymphocytes. It localises to the mitochondria.
 |
