CoraLite®594-conjugated 14-3-3 Monoclonal antibody

14-3-3 Monoclonal Antibody for IF/ICC
Cat No. CL594-66061
Clone No.2E10A3

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, mouse, pig

Applications

IF/ICC

14 3 3, 14 3 3 protein T cell, 14 3 3 protein tau, 14 3 3 protein theta, 1C5, HS1, Protein HS1, YWHAQ

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66061 targets 14-3-3 in IF/ICC applications and shows reactivity with human, rat, mouse, pig samples.

Tested Reactivity human, rat, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6055

Product name: Recombinant human 14-3-3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-245 aa of BC056867

Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 31 kDa, 28 kDa
GenBank Accession NumberBC056867
Gene Symbol 14-3-3 theta
Gene ID (NCBI) 10971
RRIDAB_2883498
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP27348
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

14-3-3 proteins interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.

Protocols

Product Specific Protocols
IF protocol for CL594 14-3-3 antibody CL594-66061Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...