CoraLite® Plus 488-conjugated 4-1BBL/TNFSF9 Recombinant monoclonal antibody

• 

  IF Staining of Raji using CL488-84185-5

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CoraLite® Plus 488 4-1BBL/TNFSF9 antibody (CL488-84185-5, Clone: 241386E7 ) at dilution of 1:200.

4-1BBL/TNFSF9 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84185-5

Clone No.241386E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

TNFSF9, 241386E7, 4 1BB L, 4 1BB ligand, 4 1BBL

---

Tested Applications

• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84185-5 targets 4-1BBL/TNFSF9 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0010

  Product name: Recombinant Human TNFSF9 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 71-254 aa of BC104805

  Sequence: REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

• Full Name: tumor necrosis factor (ligand) superfamily, member 9
• Calculated Molecular Weight: 254 aa, 27 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC104805
• Gene Symbol: TNFSF9
• Gene ID (NCBI): 8744
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41273
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages.