Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, HEK-293 cells, MCF-7 cells, LNCaP cells, HSC-T6 cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | human breast cancer tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:10000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66424-1-Ig targets Prohibitin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2977 Product name: Recombinant human PHB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC014766 Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK Predict reactive species |
| Full Name | prohibitin 2 |
| Calculated Molecular Weight | 299 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC014766 |
| Gene Symbol | Prohibitin 2 |
| Gene ID (NCBI) | 11331 |
| RRID | AB_2811041 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99623 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Prohibitin 2 antibody 66424-1-Ig | Download protocol |
| IHC protocol for Prohibitin 2 antibody 66424-1-Ig | Download protocol |
| WB protocol for Prohibitin 2 antibody 66424-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
66424-1-Ig is an anti-PHB2 antibody with 18 total citations. Citations appear in journals including Redox Biology, Journal of Cell Biology, EMBO Reports, eLife, Acta Pharmacologica Sinica, Molecular Medicine, Cell Proliferation, and others. Research fields span mitochondrial biology, mitophagy, ferroptosis, neurodegenerative diseases (Parkinson's, ALS, frontotemporal dementia), cardiovascular disease, prostate cancer, oxidative stress, and viral infection.
| Species | Application | Title |
|---|---|---|
Redox Biol PHB2 ameliorates ferroptosis and aortic aneurysm/dissection through NEDD4L-dependent ubiquitination of NCOA4. | ||
J Nanobiotechnology Exosome-delivered NR2F1-AS1 and NR2F1 drive phenotypic transition from dormancy to proliferation in treatment-resistant prostate cancer via stabilizing hormonal receptors | ||
Biosens Bioelectron Mechanical detection of interactions between proteins related to intermediate filament and transcriptional regulation in living cells | ||
Acta Pharmacol Sin PHB2 protects against pressure overload-induced myocardial remodeling in mice via stabilizing TOMM40 and regulating mitochondrial morphofunctional homeostasis | ||
Mol Med Complement protein C1q induces endothelial apoptosis through C1qBP regulation of mitochondrial function in lung endothelial cells in systemic sclerosis. | ||
Cell Prolif CircSMAD3 represses VSMC phenotype switching and neointima formation via promoting hnRNPA1 ubiquitination degradation |
