ACE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ACE Polyclonal antibody, PBS Only (24743-1-PBS)

• 

  WB analysis of mouse heart using 24743-1-AP (same clone as 24743-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 24743-1-AP (ACE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat lung using 24743-1-AP (same clone as 24743-1-PBS)

  rat lung tissue were subjected to SDS PAGE followed by western blot with 24743-1-AP (ACE antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 24743-1-AP (same clone as 24743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 24743-1-AP (same clone as 24743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 24743-1-AP (same clone as 24743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 24743-1-AP (same clone as 24743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 24743-1-AP (same clone as 24743-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24743-1-PBS in a different storage buffer formulation.

ACE Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24743-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DCP1, DCP, Angiotensin-converting enzyme, soluble form, Angiotensin-converting enzyme, Angiotensin converting enzyme

---

Product Information

24743-1-PBS targets ACE in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20654

  Product name: Recombinant human ACE protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 390-739 aa of BC036375

  Sequence: FYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYMSKRAASSGPPGSPKLPPAAQGHGEVPVHDLLWHPGPPV

• Full Name: angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
• Calculated Molecular Weight: 150 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC036375
• Gene Symbol: ACE
• Gene ID (NCBI): 1636
• RRID: AB_2879701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12821
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACE(Angiotensin-converting enzyme) is also named as DCP, DCP1 and belongs to the peptidase M2 family. It is involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE also has a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. It has 4 isoforms produced by alternative splicing. The full length protein has 15 glycosylation sites and it can show a molecular weight of 170 kDa(PMID:16804085).