Use Able AI chat for product recommendations

ACVR1 Monoclonal antibody

ACVR1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67417-1-Ig
Clone No. 1F11B10
Publications (9)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Pig, Mouse, Rat and More (3)

Applications

WB, IHC, IF-P, ELISA

activin A receptor, type I, Activin receptor like kinase 2, Activin receptor type 1, Activin receptor type I, ACTR I, ACTRI, ACVR1, ACVR1A, ACVRLK2, ALK 2, ALK2, FOP, SKR1, TSR I, TSRI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ACVR1 in ?

Tested Applications

Positive WB detected inpig brain tissue, rat brain tissue, NCI-H1299 cells, mouse brain tissue, JAR cells
Positive IHC detected inmouse heart tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67417-1-Ig targets ACVR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.

Tested Reactivity Human, Pig, Mouse, Rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13508

Product name: Recombinant human ACVR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 210-509 aa of BC033867

Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Predict reactive species
Full Name activin A receptor, type I
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC033867
Gene Symbol ACVR1
Gene ID (NCBI) 90
RRIDAB_2882657
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ04771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).

Protocols

Product Specific Protocols
IF protocol for ACVR1 antibody 67417-1-IgDownload protocol
IHC protocol for ACVR1 antibody 67417-1-IgDownload protocol
WB protocol for ACVR1 antibody 67417-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ACVR1 Monoclonal antibody (1F11B10), catalog number 67417-1-Ig, has 9 total citations. These appear in journals including EMBO Journal, Neurobiology of Disease, International Immunopharmacology, Journal of Cellular and Molecular Medicine, Neuropharmacology, Frontiers in Molecular Biosciences, Molecular Immunology, Tissue & Cell, and European Journal of Histochemistry. Research fields span osteochondral differentiation, neuropathic pain, necrotizing enterocolitis, endothelial repair, diabetic wound healing, BMP/SMAD signaling, and urinary bladder biology.

SpeciesApplicationTitle
mouseIF

EMBO J

GNAS/PKA signaling promotes aberrant osteochondral differentiation of Gli1+ tendon sheath progenitors

Authors - Lijun Chen
mouseIF

Neurobiol Dis

Neuronal ACVR1-mediated H3K18 lactylation drives NLRP3 pyroptosis to sustain neuropathic pain via metabolic-epigenetic coupling.

Authors - Xiaowei Zhao
IF

Int Immunopharmacol

Activin A exacerbates neonatal necrotizing enterocolitis via ALK4-mediated apoptosis and barrier disruption

Authors - Wenjing Ma
humanWB

J Cell Mol Med

Circulating exosomes repair endothelial cell damage by delivering miR-193a-5p.

Authors - Chang Cao
IF

Neuropharmacology

ACVR1 Drives Neuropathic Pain by Regulating NLRP3-Induced Neuronal Pyroptosis through the p38 and Smad1/5/8 Pathways

Authors - Xiaoxu Zhang
IF

Front Mol Biosci

Expression and distribution of activin-follistatin-inhibin axis in the urinary bladder

Authors - Weipu Mao
Loading...
||
New chat

Able™

正在加载,请稍候...