CoraLite® Plus 488-conjugated ACVR1B Recombinant monoclonal antibody

ACVR1B Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83026-5
Clone No.230260E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

230260E12, activin A receptor, type IB, Activin receptor like kinase 4, Activin receptor type 1B, Activin receptor type-1B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83026-5 targets ACVR1B in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0129

Product name: Recombinant human ACVR1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 211-448 aa of BC000254

Sequence: EIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVC

Predict reactive species
Full Name activin A receptor, type IB
Calculated Molecular Weight 57 kDa
GenBank Accession NumberBC000254
Gene Symbol ACVR1B
Gene ID (NCBI) 91
RRIDAB_3673173
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36896
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ACVR1B (ALK4, activin A receptor type 1B) is a transforming growth factor-beta (TGF-beta) superfamily member (PMID: 37020544). A potential role for ACVR1B in regulating muscle mass is that it is part of the transforming growth factor b (TGFb) pathway regulating myostatin (PMID: 21063444).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ACVR1B antibody CL488-83026-5Download protocol
IF protocol for CL Plus 488 ACVR1B antibody CL488-83026-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...