ADAL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAL Polyclonal antibody, PBS Only (27369-1-PBS)

• 

  WB analysis using 27369-1-AP (same clone as 27369-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27369-1-AP (ADAL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27369-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 27369-1-AP (same clone as 27369-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 27369-1-AP (ADAL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 27369-1-AP (same clone as 27369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27369-1-AP (ADAL Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 27369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 27369-1-AP (same clone as 27369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27369-1-AP (ADAL Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 27369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 27369-1-AP (same clone as 27369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27369-1-AP (ADAL Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 27369-1-AP (same clone as 27369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27369-1-AP (ADAL Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27369-1-PBS in a different storage buffer formulation.

ADAL Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27369-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27369-1-PBS targets ADAL in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25949

  Product name: Recombinant human ADAL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-200 aa of BC075857

  Sequence: ISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKK

• Full Name: adenosine deaminase-like
• Calculated Molecular Weight: 267 aa, 30 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC075857
• Gene Symbol: ADAL
• Gene ID (NCBI): 161823
• RRID: AB_2880855
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6DHV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.