Product Information
27530-1-PBS targets ADAM32 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26450 Product name: Recombinant human ADAM32 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 704-787 aa of BC026169 Sequence: RKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN Predict reactive species |
| Full Name | ADAM metallopeptidase domain 32 |
| Calculated Molecular Weight | 787 aa, 88 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC026169 |
| Gene Symbol | ADAM32 |
| Gene ID (NCBI) | 203102 |
| RRID | AB_3742238 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TC27 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ADAM32 may play a role in sperm development and fertilization and it is a non-catalytic metalloprotease-like protein. In mature sperm from cauda epididymis and vas deferens, a band of 44 kDa for ADAM32 is detected and indicates that ADAM32 is made as precursors and processed to lower molecular-weight forms during sperm maturation in the epididymis(PMID:16407499). The full length protein has a signal peptide, a propeptide and 4 glycosylation sites.
