ADAMTSL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADAMTSL1 Polyclonal antibody, PBS Only (13337-1-PBS)

• 

  WB analysis using 13337-1-AP (same clone as 13337-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13337-1-AP (ADAMTSL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13337-1-PBS in a different storage buffer formulation.

ADAMTSL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13337-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ADAMTS like 1, ADAMTS like protein 1, ADAMTSL 1, ADAMTSL-1, ADAMTS-like protein 1

---

Product Information

13337-1-PBS targets ADAMTSL1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4154

  Product name: Recombinant human ADAMTSL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC030262

  Sequence: MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECN

• Full Name: ADAMTS-like 1
• Calculated Molecular Weight: 525 aa, 58 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC030262
• Gene Symbol: ADAMTSL1
• Gene ID (NCBI): 92949
• RRID: AB_3669160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6G6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADAMTS-like genes (ADAMTSLs) produce proteins similar to those encoded by ADAMTS genes, only without catalytic domains, and may be responsible for regulating activities of ADAMTS. ADAMTSL1 was first identified in 1997 and was called punctin. ADAMTSL1 is distinct from other genes in the ADAMTS family, and binds to the extracellular matrix in a spatially-specific manner. (PMID: 32095376)