ADORA2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADORA2A Polyclonal antibody, PBS Only (51092-1-PBS)

• 

  WB analysis of mouse brain using 51092-1-AP (same clone as 51092-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 51092-1-AP (ADORA2A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51092-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 51092-1-AP (same clone as 51092-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 51092-1-AP (ADORA2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51092-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 51092-1-AP (same clone as 51092-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 51092-1-AP (ADORA2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51092-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 51092-1-AP (same clone as 51092-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 51092-1-AP (ADORA2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51092-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 51092-1-AP (same clone as 51092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 51092-1-AP (ADORA2A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 51092-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 51092-1-AP (same clone as 51092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 51092-1-AP (ADORA2A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 51092-1-PBS in a different storage buffer formulation.

ADORA2A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 51092-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

adenosine A2a receptor, Adenosine receptor A2a, ADORA2, RDC8

---

Product Information

51092-1-PBS targets ADORA2A in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0470

  Product name: Recombinant human ADORA2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-412 aa of BC013780

  Sequence: RKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

• Full Name: adenosine A2a receptor
• Calculated Molecular Weight: 412 aa, 45 kDa
• Observed Molecular Weight: 38 kDa, 40-45 kDa
• GenBank Accession Number: BC013780
• Gene Symbol: ADORA2A
• Gene ID (NCBI): 135
• RRID: AB_2881245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29274
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Adenosine (ADO) is a retaliatory metabolite that is expressed in conditions of injury or stress. Its physiological functions are mediated through interaction with four specific transmembrane receptors called ADORA1, ADORA2A, ADORA2B, and ADORA3 (PMID:23994158). ADORA2A (adenosine A2A receptor) has been shown to dampen inflammatory responses. ADORA2A signaling has been discovered on polymorphonuclear neutrophils (PMNs) (PMID:36009485).