ADRB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADRB2 Polyclonal antibody, PBS Only (29864-1-PBS)

• 

  WB analysis using 29864-1-AP (same clone as 29864-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29864-1-AP (ADRB2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29864-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse stomach using 29864-1-AP (same clone as 29864-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse stomach tissue using ADRB2 antibody (29864-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29864-1-PBS in a different storage buffer formulation.

ADRB2 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 29864-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, Indirect ELISA

Synonyms

ADRB2R, ADRBR, B2AR, BAR, Beta 2 adrenergic receptor

---

Product Information

29864-1-PBS targets ADRB2 in WB, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32313

  Product name: Recombinant human ADRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-413 aa of BC012481

  Sequence: PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL

• Full Name: adrenergic, beta-2-, receptor, surface
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46-48 kDa
• GenBank Accession Number: BC012481
• Gene Symbol: ADRB2
• Gene ID (NCBI): 154
• RRID: AB_2923616
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07550
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity, and type 2 diabetes. This antibody detects ADRB2 with a molecular weight of 46-48 kDa, as has been shown by some researches (PMID: 30542705; 35075132).