Product Information
29864-1-PBS targets ADRB2 in WB, IF-P, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32313 Product name: Recombinant human ADRB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 330-413 aa of BC012481 Sequence: PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSPGRNCSTNDSLL Predict reactive species |
| Full Name | adrenergic, beta-2-, receptor, surface |
| Calculated Molecular Weight | 46 kDa |
| Observed Molecular Weight | 46-48 kDa |
| GenBank Accession Number | BC012481 |
| Gene Symbol | ADRB2 |
| Gene ID (NCBI) | 154 |
| RRID | AB_2923616 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07550 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Beta-2 adrenergic receptor (ADRB2), a member of the G protein-coupled receptor (GPCR) family, binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. ADRB2 is directly linked to one of its final effectors, the class C L-type Ca2+ channel, Cav1.2 (PMID: 11441182). This receptor-channel complex also contains a G protein, an adenylyl cyclase, cyclic adenosine monophosphate-dependent protein kinase (PKA), and a counteracting phosphatase, PP2A. Different polymorphic forms, point mutations, and/or downregulation of the gene of ADRB2 are associated with nocturnal asthma, obesity, and type 2 diabetes. This antibody detects ADRB2 with a molecular weight of 46-48 kDa, as has been shown by some researches (PMID: 30542705; 35075132).



