ADRBK1 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67067-1-Ig (same clone as 67067-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67067-1-Ig (ADRBK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 67067-1-Ig (same clone as 67067-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 67067-1-Ig (ADRBK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 67067-1-Ig (same clone as 67067-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ADRBK1 antibody (67067-1-Ig, Clone: 2F7A5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67067-1-Ig (same clone as 67067-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ADRBK1 (67067-1-Ig, Clone:2F7A5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67067-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51612-1

  Cytometric bead array sample test of MP51612-1, ADRBK1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67067-2-PBS. Detection antibody: 67067-1-PBS.

• 

  Cytometric bead array standard curve of MP51612-1

  Cytometric bead array standard curve of MP51612-1, ADRBK1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67067-2-PBS. Detection antibody: 67067-1-PBS. Standard:Ag5071. Range: 3.125-400 ng/mL.

ADRBK1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 67067-1-PBS

Clone No.2F7A5

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

ARBK1, GRK2, BARK, BARK1, Beta ARK 1

---

Product Information

67067-1-PBS targets ADRBK1 as part of a matched antibody pair:

MP51612-1: 67067-2-PBS capture and 67067-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5071

  Product name: Recombinant human ADRBK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 390-689 aa of BC037963

  Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL

• Full Name: adrenergic, beta, receptor kinase 1
• Calculated Molecular Weight: 689 aa, 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC037963
• Gene Symbol: ADRBK1
• Gene ID (NCBI): 156
• RRID: AB_2882377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25098
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.