ADRBK1 Monoclonal antibody

• 

  WB analysis using 67067-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67067-1-Ig (ADRBK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 67067-1-Ig

  U-937 cells were subjected to SDS PAGE followed by western blot with 67067-1-Ig (ADRBK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 67067-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 67067-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67067-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67067-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67067-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67067-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67067-1-Ig (ADRBK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Jurkat using 67067-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ADRBK1 antibody (67067-1-Ig, Clone: 2F7A5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 67067-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ADRBK1 (67067-1-Ig, Clone:2F7A5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

ADRBK1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 67067-1-Ig

Clone No.2F7A5

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA

Synonyms

ARBK1, GRK2, BARK, BARK1, Beta ARK 1

---

Tested Applications

• Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells, K-562 cells, Jurkat cells
• Positive IHC detected in: human lymphoma tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

67067-1-Ig targets ADRBK1 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5071

  Product name: Recombinant human ADRBK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 390-689 aa of BC037963

  Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL

• Full Name: adrenergic, beta, receptor kinase 1
• Calculated Molecular Weight: 689 aa, 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC037963
• Gene Symbol: ADRBK1
• Gene ID (NCBI): 156
• RRID: AB_2882377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25098
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF,CoIP	Phytother Res; Paeoniflorin-6'-O-benzene sulfonate protected the intestinal epithelial barrier by restoring the inhibitory effect of GRK2 and β-arrestin 2 on ERK1/2-NF-κB; Authors - Mengya Jiang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Charlotte (Verified Customer) (08-05-2024)

I tested the antibody in several cells (here shown RPE1 cells). The GRK2 signal (Cy3) versus the nuclei (Dapi).

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/400
• Cell Tissue Type: RPE1

ADRBK1 Antibody Immunofluorescence validation (1/400 dilution) in RPE1 (Cat no:67067-1-Ig)