ADSSL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ADSSL1 Polyclonal antibody, PBS Only (34472-1-PBS)

• 

  WB analysis using 34472-1-AP (same clone as 34472-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34472-1-AP (ADSSL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34472-1-PBS in a different storage buffer formulation.

ADSSL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34472-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, Adenylosuccinate synthetase-like 1, AdSS 1

---

Product Information

34472-1-PBS targets ADSSL1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40667

  Product name: Recombinant human ADSSL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 365-457 aa of BC047904

  Sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF

• Full Name: adenylosuccinate synthase like 1
• Calculated Molecular Weight: 457 aa, 50 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC047904
• Gene Symbol: ADSSL1
• Gene ID (NCBI): 122622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N142
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Adenylosuccinate synthase (ADSSL1) is a muscle specific enzyme involved in the purine nucleotide cycle and responsible for the conversion of inosine monophosphate to adenosine monophosphate (PMID: 32331917).