• Featured Product
  • KD/KO Validated

CoraLite® Plus 750-conjugated AFP Recombinant monoclonal antibody

AFP Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-81083
Clone No.2D17

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB

AFP, Alpha 1 fetoprotein, Alpha fetoglobulin, alpha fetoprotein, FETA, HPAFP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HuH-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-81083 targets AFP in WB applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6089

Product name: Recombinant human AFP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 260-609 aa of BC027881

Sequence: LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

Predict reactive species
Full Name alpha-fetoprotein
Calculated Molecular Weight 69 kDa
Observed Molecular Weight68-72 kDa
GenBank Accession NumberBC027881
Gene Symbol AFP
Gene ID (NCBI) 174
RRIDAB_3673723
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02771
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AFP, also known as Alpha-fetoprotein, is a major plasma protein in the fetus and its concentration is very low in the adult (PubMed:24120489). AFP is considered a marker of hepatocyte precursors. AFP can be detected at abnormally high concentrations in hepatocellular carcinomas as well as in the plasma and ascitic fluid of adults with hepatoma. High AFP concentrations have been correlated with tumor cell growth, indicating that AFP can serve as a tumor marker (PubMed: 18669658).

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 AFP antibody CL750-81083Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...