• Featured Product
  • KD/KO Validated

AFP Recombinant monoclonal antibody

AFP Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 81083-1-RR
Clone No.2D17

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

2D17, Alpha fetoglobulin, alpha fetoprotein, Alpha-1-fetoprotein, Alpha-fetoglobulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HuH-7 cells, human placenta tissue
Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81083-1-RR targets AFP in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6089

Product name: Recombinant human AFP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 260-609 aa of BC027881

Sequence: LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

Predict reactive species
Full Name alpha-fetoprotein
Calculated Molecular Weight 69 kDa
Observed Molecular Weight68-72 kDa
GenBank Accession NumberBC027881
Gene Symbol AFP
Gene ID (NCBI) 174
RRIDAB_2923701
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AFP (Alpha-fetoprotein) is a major plasma protein in the fetus and its concentration is very low in the adult (PMID:24120489). AFP can be detected at abnormally high concentrations in hepatocellular carcinomas as well as in the plasma and ascitic fluid of adults with hepatoma, indicating that AFP can serve as a tumor marker (PMID: 18669658). AFP is also a glycosylated protein and based on its binding capability to lectin Lens Culinaris Agglutinin (LCA), and total AFP can be separated into three different glycoforms, AFP-L1, AFP-L2, and AFP-L3. Core-fucosylated form of AFP (AFP-L3) is a more specific indicator than total AFP for HCC (PMID: 33128033, 35458505)

Protocols

Product Specific Protocols
IHC protocol for AFP antibody 81083-1-RRDownload protocol
WB protocol for AFP antibody 81083-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...