AGBL5/CCP5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AGBL5/CCP5 Polyclonal antibody, PBS Only (15569-1-PBS)

• 

  WB analysis of recombinant protein using 15569-1-AP (same clone as 15569-1-PBS)

  WB result of 15569-1-AP (anti-CCP5): Fusion protein expressed in Baculovirus.(From Dr. Jason Ford). This data was developed using the same antibody clone with 15569-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 15569-1-AP (same clone as 15569-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15569-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 15569-1-AP (same clone as 15569-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15569-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15569-1-AP (same clone as 15569-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15569-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15569-1-AP (same clone as 15569-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15569-1-AP (AGBL5/CCP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15569-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 15569-1-PBS

  Immunofluorescent analysis of (-20°C Methanol) fixed U-251 cells using AGBL5/CCP5 antibody (15569-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

AGBL5/CCP5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15569-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

---

Product Information

15569-1-PBS targets AGBL5/CCP5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7889

  Product name: Recombinant human AGBL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 466-816 aa of BC007415

  Sequence: SLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPAGLPGLGSSTQKVTHRVLGPVREPRSQDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSSCSLLSSGDKPEAVMVIGKGLLGTGARMPCIKTRLQTCPRRVSARRGPGFPRLGPGWAGAHRRLAEG

• Full Name: ATP/GTP binding protein-like 5
• Calculated Molecular Weight: 98 kDa
• GenBank Accession Number: BC007415
• Gene Symbol: AGBL5/CCP5
• Gene ID (NCBI): 60509
• RRID: AB_2878151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NDL9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.