AHCTF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AHCTF1 Polyclonal antibody, PBS Only (30923-1-PBS)

• 

  WB analysis using 30923-1-AP (same clone as 30923-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30923-1-AP (AHCTF1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30923-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30923-1-AP (same clone as 30923-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using AHCTF1 antibody (30923-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 30923-1-PBS in a different storage buffer formulation.

AHCTF1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30923-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ELYS, TMBS62, MSTP108, MST108

---

Product Information

30923-1-PBS targets AHCTF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32788

  Product name: Recombinant human AHCTF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2067-2266 aa of NM_001323342.1

  Sequence: ERTDEMTHKETNEQEERLLATASFTKSSRSSRTRSSKAILLPDLSEPNNEPLFSPASEVPRKAKAKKIEVPAQLKELVSDLSSQFVISPPALRSRQKNTSNKNKLEDELKDDAQSVETLGKPKAKRIRTSKTKQASKNTEKESAWSPPPIEIRLISPLASPADGVKSKPRKTTEVTGTGLGRNRKKLSSYPKQILRRKML

• Full Name: AT hook containing transcription factor 1
• Calculated Molecular Weight: 252 kDa
• Observed Molecular Weight: 270 kDa
• GenBank Accession Number: NM_001323342.1
• Gene Symbol: AHCTF1
• Gene ID (NCBI): 25909
• RRID: AB_3669786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WYP5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AHCTF1, also known as ELYS, TMBS62, is a large multifunctional protein. It plays essential roles in nuclear pore assembly and mitosis. AHCTF1 was expressed at higher levels in embryonic liver, spleen and thymus compared to the corresponding adult tissues (PMID: 11952839) and has 3 isoforms with MW of 252~256 kDa.