• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated AHR Monoclonal antibody

AHR Monoclonal Antibody for FC (Intra)
Cat No. CL488-67785
Clone No.2D1F9

Host / Isotype

Mouse / IgG2b

Reactivity

Human, rat

Applications

FC (Intra)

AHR, bHLHe76, Class E basic helix-loop-helix protein 76, 2D1F9, Ah receptor

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67785 targets AHR in FC (Intra) applications and shows reactivity with Human, rat samples.

Tested Reactivity Human, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28935

Product name: Recombinant human AHR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-300 aa of BC070080

Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC

Predict reactive species
Full Name aryl hydrocarbon receptor
Calculated Molecular Weight 848 aa, 96 kDa
Observed Molecular Weight105-110 kDa
GenBank Accession NumberBC070080
Gene Symbol AHR
Gene ID (NCBI) 196
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35869
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)

Loading...
||
New chat Able
正在加载,请稍候...