AIFM2/ FSP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AIFM2/ FSP1 Polyclonal antibody, PBS Only (20886-1-PBS)

• 

  WB analysis using 20886-1-AP (same clone as 20886-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20886-1-AP (same clone as 20886-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20886-1-AP (same clone as 20886-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• 

  IP experiment of L02 using 20886-1-AP (same clone as 20886-1-PBS)

  IP result of anti-AIFM2/ FSP1 (IP:20886-1-AP, 4ug; Detection:20886-1-AP 1:3000) with L02 cells lysate 1040 ug. This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 20886-1-AP (same clone as 20886-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 20886-1-AP (same clone as 20886-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 20886-1-AP (same clone as 20886-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using AIFM2/ FSP1 antibody (20886-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 20886-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AIFM2/ FSP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20886-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

AIFM2, AMID, FSP1, AIFM 2, Apoptosis inducing factor 2

---

Product Information

20886-1-PBS targets AIFM2/ FSP1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13412

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2878756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis-associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis-Inducing Factor), a mitochondrion-associated enzyme that relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.