Product Information
24986-1-PBS targets AKAP4 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21762 Product name: Recombinant human AKAP4 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 565-693 aa of BC126252 Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN Predict reactive species |
| Full Name | A kinase (PRKA) anchor protein 4 |
| Calculated Molecular Weight | 854 aa, 94 kDa |
| Observed Molecular Weight | 82 kDa |
| GenBank Accession Number | BC126252 |
| Gene Symbol | AKAP4 |
| Gene ID (NCBI) | 8852 |
| RRID | AB_2876859 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5JQC9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
AKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility.

