AKAP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AKAP4 Polyclonal antibody, PBS Only (24986-1-PBS)

• 

  WB analysis of human testis using 24986-1-AP (same clone as 24986-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 24986-1-AP (AKAP4 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24986-1-PBS in a different storage buffer formulation.

AKAP4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24986-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

AKAP-4, AKAP82, A-kinase anchor protein 4, A-kinase anchor protein 82 kDa, hAKAP82

---

Product Information

24986-1-PBS targets AKAP4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21762

  Product name: Recombinant human AKAP4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 565-693 aa of BC126252

  Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN

• Full Name: A kinase (PRKA) anchor protein 4
• Calculated Molecular Weight: 854 aa, 94 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC126252
• Gene Symbol: AKAP4
• Gene ID (NCBI): 8852
• RRID: AB_2876859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JQC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility.