CoraLite® Plus 488-conjugated AKT2 Polyclonal antibody

AKT2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-28113

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

AKT 2, AKT2 protein, EC:2.7.11.1, PKB beta, PKBB

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28113 targets AKT2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27005

Product name: Recombinant human AKT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 335-481 aa of BC120994

Sequence: GLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE

Predict reactive species
Full Name v-akt murine thymoma viral oncogene homolog 2
Observed Molecular Weight56 kDa
GenBank Accession NumberBC120994
Gene Symbol AKT2
Gene ID (NCBI) 208
RRIDAB_3672822
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31751
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AKT2 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis and their activation has been observed in a wide variety of cancers. AKT2 is mainly involved in cancer cell survival, apoptosis inhibition, migration and invasion(PMID:21979951). Defects in AKT2 are a cause of susceptibility to breast cancer (BC). AKT2 promotes metastasis of tumor cells without affecting the latency of tumor development. And defects in AKT2 are a cause of non-insulin-dependent diabetes mellitus (NIDDM) and hypoinsulinemic hypoglycemia with hemihypertrophy (HIHGHH). The full length protein has four glycosylation sites.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 AKT2 antibody CL488-28113Download protocol
IF protocol for CL Plus 488 AKT2 antibody CL488-28113Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...