ALDH5A1 Monoclonal antibody, PBS Only

• 

  WB analysis of L02 using 67347-1-Ig (same clone as 67347-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67347-1-Ig (same clone as 67347-1-PBS)

  WB result of ALDH5A1 antibody (67347-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ALDH5A1 transfected HepG2 cells. This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67347-1-Ig (same clone as 67347-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67347-1-Ig (same clone as 67347-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67347-1-Ig (same clone as 67347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67347-1-Ig (same clone as 67347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67347-1-Ig (same clone as 67347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67347-1-Ig (same clone as 67347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67347-1-Ig (ALDH5A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67347-1-Ig (same clone as 67347-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using ALDH5A1 antibody (67347-1-Ig, Clone: 1B9H10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue). This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 67347-1-Ig (same clone as 67347-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using ALDH5A1 antibody (67347-1-Ig, Clone: 1B9H10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 67347-1-Ig (same clone as 67347-1-PBS)

  1X10^6 A431 cells were intracellularly stained with 0.4 ug Anti-Human ALDH5A1 (67347-1-Ig, Clone:1B9H10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67347-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ALDH5A1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 67347-1-PBS

Clone No.1B9H10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

1B9H10, EC:1.2.1.24, NAD(+)-dependent succinic semialdehyde dehydrogenase, SSADH, SSDH

---

Product Information

67347-1-PBS targets ALDH5A1 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11155

  Product name: Recombinant human ALDH5A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 175-535 aa of BC034321

  Sequence: YGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL

• Full Name: aldehyde dehydrogenase 5 family, member A1
• Calculated Molecular Weight: 535 aa, 57 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC034321
• Gene Symbol: ALDH5A1
• Gene ID (NCBI): 7915
• RRID: AB_2882605
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P51649
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.