• Featured Product
  • KD/KO Validated

ALDH5A1 Monoclonal antibody

ALDH5A1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 67347-1-Ig
Clone No.1B9H10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

1B9H10, EC:1.2.1.24, NAD(+)-dependent succinic semialdehyde dehydrogenase, SSADH, SSDH

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, HepG2 cells, pig brain tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue, mouse liver tissue
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67347-1-Ig targets ALDH5A1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11155

Product name: Recombinant human ALDH5A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 175-535 aa of BC034321

Sequence: YGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL

Predict reactive species
Full Name aldehyde dehydrogenase 5 family, member A1
Calculated Molecular Weight 535 aa, 57 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC034321
Gene Symbol ALDH5A1
Gene ID (NCBI) 7915
RRIDAB_2882605
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP51649
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for ALDH5A1 antibody 67347-1-IgDownload protocol
IF protocol for ALDH5A1 antibody 67347-1-IgDownload protocol
IHC protocol for ALDH5A1 antibody 67347-1-IgDownload protocol
WB protocol for ALDH5A1 antibody 67347-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...