ALPI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALPI Polyclonal antibody, PBS Only (33485-1-PBS)

• 

  WB analysis using 33485-1-AP (same clone as 33485-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33485-1-AP (ALPI antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33485-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 33485-1-AP (same clone as 33485-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33485-1-AP (ALPI antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33485-1-PBS in a different storage buffer formulation.

ALPI Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33485-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:3.1.3.1, IAP, Intestinal alkaline phosphatase, Intestinal-type alkaline phosphatase

---

Product Information

33485-1-PBS targets ALPI in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36025

  Product name: Recombinant human ALPI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-220 aa of BC132678

  Sequence: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILG

• Full Name: alkaline phosphatase, intestinal
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC132678
• Gene Symbol: ALPI
• Gene ID (NCBI): 248
• RRID: AB_3742989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P09923
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ALPI (intestinal alkaline phosphatase) is a brush-border enzyme expressed in the gut that plays a critical role in maintaining intestinal homeostasis. By dephosphorylating pro-inflammatory microbial products, it helps prevent bacterial translocation and systemic inflammation. Dysfunction or deficiency of ALPI is linked to conditions such as increased intestinal permeability, metabolic disorders, and inflammatory diseases, making it a promising therapeutic target for preserving gut health.