CoraLite® Plus 488-conjugated AMPK Alpha Recombinant monoclonal antibody

AMPK Alpha Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-80209-5
Clone No.4N5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

AMPK Alpha 1, PRKAA1, 5'-AMP-activated protein kinase catalytic subunit alpha-1, AAPK1, ACACA kinase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inrat brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80209-5 targets AMPK Alpha in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1367

Product name: Recombinant human AMPK alpha protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC012622

Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

Predict reactive species
Full Name protein kinase, AMP-activated, alpha 1 catalytic subunit
Calculated Molecular Weight 63 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC012622
Gene Symbol AMPK Alpha 1
Gene ID (NCBI) 5562
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13131
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing. 80209-5-RR can recognize both AMPK Alpha 1 and AMPK Alpha 2.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 AMPK Alpha antibody CL488-80209-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...