CoraLite®594-conjugated AMPK Beta 2 Monoclonal antibody

AMPK Beta 2 Monoclonal Antibody for IF/ICC
Cat No. CL594-66579
Clone No.2D5C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF/ICC

AMPK subunit beta 2, PRKAB2

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66579 targets AMPK Beta 2 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5806

Product name: Recombinant human PRKAB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of BC053610

Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

Predict reactive species
Full Name protein kinase, AMP-activated, beta 2 non-catalytic subunit
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC053610
Gene Symbol AMPK Beta 2
Gene ID (NCBI) 5565
RRIDAB_2934734
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43741
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AMPK beta 2 is a regulatory subunit of the AMP-activated protein kinase (AMPK), which is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK beta 2 may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles.

Protocols

Product Specific Protocols
IF protocol for CL594 AMPK Beta 2 antibody CL594-66579Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...