ANAPC10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ANAPC10 Polyclonal antibody, PBS Only (15788-1-PBS)

• 

  WB analysis using 15788-1-AP (same clone as 15788-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15788-1-AP (ANAPC10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15788-1-AP (same clone as 15788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15788-1-AP (ANAPC10 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15788-1-AP (same clone as 15788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15788-1-AP (ANAPC10 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15788-1-PBS in a different storage buffer formulation.

ANAPC10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15788-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ANAPC 10, Anaphase-promoting complex subunit 10, APC10, DOC1

---

Product Information

15788-1-PBS targets ANAPC10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8487

  Product name: Recombinant human ANAPC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC005217

  Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR

• Full Name: anaphase promoting complex subunit 10
• Calculated Molecular Weight: 185 aa, 21 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005217
• Gene Symbol: ANAPC10
• Gene ID (NCBI): 10393
• RRID: AB_3669220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UM13
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Anaphase-promoting complex subunit 10 (Anapc10) is a component of the promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase.Anapc10 recognizes ubiquitination-mediated degradation of substrates, and is expressed predominantly in the cytoplasm of spermatogonial and leptoblast cells.