CoraLite®594-conjugated ANGPTL8 Monoclonal antibody

• 

  IF Staining of human liver using CL594-66641

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CoraLite®594 ANGPTL8 antibody (CL594-66641, Clone: 2H9F9 ) at dilution of 1:200.

ANGPTL8 Monoclonal Antibody for IF-P

Cat No. CL594-66641

Clone No.2H9F9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF-P

Synonyms

ANGPTL8, C19orf80, LOC55908, PRO1185, PVPA599, td26

---

Tested Applications

• Positive IF-P detected in: human liver tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66641 targets ANGPTL8 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20708

  Product name: Recombinant human LOC55908 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 117-251 aa of BC146552

  Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

• Full Name: hepatocellular carcinoma-associated gene TD26
• Calculated Molecular Weight: 251 aa, 28 kDa
• GenBank Accession Number: BC146552
• Gene Symbol: ANGPTL8
• Gene ID (NCBI): 55908
• RRID: AB_2920018
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6UXH0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.