ANGPTL8/Betatrophin Monoclonal antibody

• Home
• Products
• Primary Antibodies
• ANGPTL8/Betatrophin Monoclonal antibody (66641-1-Ig)

ANGPTL8/Betatrophin Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66641-1-Ig Copied!

Clone No. 2H9F9

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

Angiopoietin-like protein 8, ANGPTL8, Betatrophin, C19orf80, Lipasin, LOC55908, PRO1185, PVPA599, td26

• 

  WB analysis of human adipose using 66641-1-Ig

  human adipose tissue were subjected to SDS PAGE followed by western blot with 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66641-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66641-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66641-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66641-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver using 66641-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using ANGPTL8/Betatrophin antibody (66641-1-Ig, Clone: 2H9F9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ANGPTL8/Betatrophin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human adipose tissue
• Positive IHC detected in: human liver tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66641-1-Ig targets ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20708

  Product name: Recombinant human LOC55908 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 117-251 aa of BC146552

  Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

• Full Name: hepatocellular carcinoma-associated gene TD26
• Calculated Molecular Weight: 251 aa, 28 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC146552
• Gene Symbol: ANGPTL8
• Gene ID (NCBI): 55908
• RRID: AB_2882000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6UXH0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ANGPTL8/Betatrophin Monoclonal antibody (2H9F9), catalog number 66641-1-Ig, has 1 total citation. It appears in the British Journal of Pharmacology (Impact Factor 7.5), published in February 2021. The cited study investigated sodium rutin's effects on lifespan, health span, and liver health in mice, using this antibody for Western blot analysis in human samples. The associated research fields include pharmacology, aging, and hepatic biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Br J Pharmacol; Sodium rutin extends lifespan and health span in mice including positive impacts on liver health.; Authors - Shuoshuo Li