Tested Applications
| Positive WB detected in | human adipose tissue |
| Positive IHC detected in | human liver tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66641-1-Ig targets ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20708 Product name: Recombinant human LOC55908 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 117-251 aa of BC146552 Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA Predict reactive species |
| Full Name | hepatocellular carcinoma-associated gene TD26 |
| Calculated Molecular Weight | 251 aa, 28 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC146552 |
| Gene Symbol | ANGPTL8 |
| Gene ID (NCBI) | 55908 |
| RRID | AB_2882000 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q6UXH0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ANGPTL8/Betatrophin antibody 66641-1-Ig | Download protocol |
| IHC protocol for ANGPTL8/Betatrophin antibody 66641-1-Ig | Download protocol |
| WB protocol for ANGPTL8/Betatrophin antibody 66641-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











